Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Cytokeratin 15 (KRT15) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 357-456 of human Cytokeratin 15 (KRT15) (KRT15) (P19012) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Cytokeratin 15 (KRT15) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 357-456 of human Cytokeratin 15 (KRT15) (KRT15) (P19012) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16605A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Cytokeratin 15 (KRT15) |
| Target Synonyms | K15; CK15; K1CO; Cytokeratin 15 (KRT15) | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Cal-27 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 357-456 of human Cytokeratin 15 (KRT15) (KRT15) (P19012). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGIAIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI | Uniprot ID | P19012 |
Uniprot Id
P19012
Target Species
Human
Target Name
KRT15
Target Full Name
Keratin, type I cytoskeletal 15
Target Synonyms
AI528832; CK 15; CK-15; CK15; Cytokeratin-15; Cytokeratin15; K15; K1C15_HUMAN; K1CO; Ka15; Keratin 15 ; Keratin 15 basic; Keratin 15 beta; Keratin; Keratin complex 1 acidic gene 15; Keratin type I cytoskeletal 15; Keratin-15; Keratin15; KRT 15; Krt1-15; KRT15; KRTB; KRTL15; Type I cytoskeletal 15; Type I keratin Ka15
Target Background
The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
