Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HPRT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 119-218 of human HPRT11 (NP_000185.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HPRT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 119-218 of human HPRT11 (NP_000185.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17185A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HPRT1 |
| Target Synonyms | HPRT; HGPRT; T1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, NIH/3T3, Rat heart, 293T, Mouse brain, Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 119-218 of human HPRT11 (NP_000185.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA | Uniprot ID | P00492 |
Uniprot Id
P00492
Target Species
Human
Target Name
HPRT1
Target Full Name
Hypoxanthine-guanine phosphoribosyltransferase
Target Function
Converts guanine to guanosine monophosphate, and hypoxanthine to inosine monophosphate. Transfers the 5-phosphoribosyl group from 5-phosphoribosylpyrophosphate onto the purine. Plays a central role in the generation of purine nucleotides through the purine salvage pathway.
Target Involvement
Lesch-Nyhan syndrome (LNS); Gout HPRT-related (GOUT-HPRT)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Purine/pyrimidine phosphoribosyltransferase family
Target Research Area
Metabolism
Target Synonyms
HGPRT; HGPRTase; HPRT 1; HPRT_HUMAN; HPRT1; Hypoxanthine guanine phosphoribosyltransferase ; Hypoxanthine phosphoribosyltransferase 1 (Lesch Nyhan syndrome); Hypoxanthine phosphoribosyltransferase 1; Hypoxanthine-guanine phosphoribosyltransferase
Target Background
The protein encoded by this gene is a transferase, which catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate. This enzyme plays a central role in the generation of purine nucleotides through the purine salvage pathway. Mutations in this gene result in Lesch-Nyhan syndrome or gout.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
