-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LIN7C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LIN7C (NP_060832.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against LIN7C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LIN7C (NP_060832.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00219A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LIN7C |
| Target Synonyms | MALS3; VELI3; LIN-7C; MALS-3; LIN-7-C; LIN7C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, HepG2, Rat kidney, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LIN7C (NP_060832.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVR | Uniprot ID | Q9NUP9 |
Uniprot Id
Q9NUP9
Target Species
Human
Target Name
LIN7C
Target Full Name
Protein lin-7 homolog C
Target Function
Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules. This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Basolateral cell membrane; Peripheral membrane protein. Cell junction. Cell junction, synapse, postsynaptic density membrane; Peripheral membrane protein. Cell junction, tight junction.
Target Protein Families
Lin-7 family
Target Synonyms
hLin 7; hLin7; LIN 7; Lin 7 homolog A; LIN 7A; LIN 7B; LIN 7C; Lin-7C; Lin7 homolog A; LIN7A; LIN7C; LIN7C_HUMAN; MALS 1; MALS; MALS-3; MALS1; Mammalian LIN 7 1; Mammalian lin seven protein 1; Mammalian lin-seven protein 3; Mammalian LIN7 1; MGC148143; Protein lin 7 homolog B; Protein lin 7 homolog C; Protein lin-7 homolog C; protein lin7 homolog A ; Tax interaction protein 33; TIP 33; TIP33; VELI 1; Veli 1 protein; Veli-3; VELI1; Velis; Vertebrate LIN 7 homolog 1; Vertebrate lin-7 homolog 3; Vertebrate LIN7 homolog 1
Target Background
Enables L27 domain binding activity and cytoskeletal protein binding activity. Involved in morphogenesis of an epithelial sheet. Located in cell-cell junction; cytoplasm; and plasma membrane. Part of MPP7-DLG1-LIN7 complex.
Notification