Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SAA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human SAA4 (NP_006503.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SAA4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human SAA4 (NP_006503.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00293A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SAA4 |
| Target Synonyms | CSAA; C-SAA; SAA4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, 293T, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human SAA4 (NP_006503.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDCYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY | Uniprot ID | P35542 |
Uniprot Id
P35542
Target Species
Human
Target Name
SAA4
Target Full Name
Serum amyloid A-4 protein
Target Function
Major acute phase reactant.
Target Subcellular Location
Secreted.
Target Protein Families
SAA family
Target Tissue Specificity
Expressed by the liver; secreted in plasma.
Target Synonyms
Amyloid A; serum; 4; C SAA; C-SAA; Constitutively expressed serum amyloid A protein; CSAA; SAA 4; Saa4; SAA4 protein; SAA4_HUMAN; Serum amyloid A 4 protein; Serum amyloid A-4 protein; Serum amyloid A4 constitutive
Target Background
Predicted to be involved in acute-phase response. Located in extracellular exosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
