-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against BAF60a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of mouse BAF60a (NP_114030.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against BAF60a was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of mouse BAF60a (NP_114030.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00851A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | BAF60a |
| Target Synonyms | Baf60a; D15Kz1; BAF60a | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, BT-474, HepG2, K-562, Mouse brain, Rat testis, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of mouse BAF60a (NP_114030.2). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MAARAGFQSVAPSGGAGASGGAGVAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRN | Uniprot ID | Q96GM5 |
Uniprot Id
Q96GM5
Target Species
Human
Target Name
SMARCD1
Target Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
Target Function
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. Has a strong influence on vitamin D-mediated transcriptional activity from an enhancer vitamin D receptor element (VDRE). May be a link between mammalian SWI-SNF-like chromatin remodeling complexes and the vitamin D receptor (VDR) heterodimer. Mediates critical interactions between nuclear receptors and the BRG1/SMARCA4 chromatin-remodeling complex for transactivation.
Target Subcellular Location
Nucleus.
Target Protein Families
SMARCD family
Target Tissue Specificity
Expressed in all tissues tested, including brain, heart, kidney, liver, lung, muscle, pancreas and placenta.
Target Synonyms
60 kDa BRG-1/Brm-associated factor subunit A; 60 kDa BRG1/Brm associated factor subunit A; BAF60A; BRG1 associated factor 60A; BRG1-associated factor 60A; Chromatin remodeling complex BAF60A subunit; CRACD1; Mammalian chromatin remodeling complex BRG1 associated factor 60A; Rsc6p; SMARCD1; SMRD1; SMRD1_HUMAN; SWI/SNF complex 60 kDa subunit A; SWI/SNF complex 60 kDa subunit; SWI/SNF related matrix associated actin dependent regulator of chromatin d1; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1; Swp73 like protein
Target Background
Predicted to enable several functions, including chromatin binding activity; molecular adaptor activity; and transcription coregulator activity. Predicted to be involved in epigenetic maintenance of chromatin in transcription-competent conformation; nucleosome disassembly; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within chromatin organization and nervous system development. Part of SWI/SNF complex; nBAF complex; and npBAF complex. Is expressed in several structures, including central nervous system; dorsal root ganglion; early conceptus; genitourinary system; and retina layer. Human ortholog(s) of this gene implicated in Coffin-Siris syndrome. Orthologous to human SMARCD1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1).
Notification