Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HECTD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2518-2610 of human HECTD1 (NP_056197.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HECTD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2518-2610 of human HECTD1 (NP_056197.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00988A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HECTD1 |
| Target Synonyms | EULIR; HECTD1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, LO2, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2518-2610 of human HECTD1 (NP_056197.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGFLRFVRVLCGMSSDERKAFLQFTTGCSTLPPGGLANLHPRLTVVRKVDATDASYPSVNTCVHYLKLPEYSSEEIMRERLLAATMEKGFHLN | Uniprot ID | Q9ULT8 |
Uniprot Id
Q9ULT8
Target Species
Human
Target Name
HECTD1
Target Full Name
E3 ubiquitin-protein ligase HECTD1
Target Function
E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates 'Lys-63'-linked polyubiquitination of HSP90AA1 which leads to its intracellular localization and reduced secretion. Negatively regulating HSP90AA1 secretion in cranial mesenchyme cells may impair their emigration and may be essential for the correct development of the cranial neural folds and neural tube closure.
Target Protein Families
UPL family, K-HECT subfamily
Target Synonyms
E3 ligase for inhibin receptor; E3 ubiquitin protein ligase HECTD1; E3 ubiquitin-protein ligase HECTD1; EULIR; HECD1_HUMAN; HECT domain containing protein 1; HECT domain-containing protein 1; HECTD1; KIAA1131
Target Background
Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in anatomical structure development; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; and protein K63-linked ubiquitination. Predicted to act upstream of or within several processes, including animal organ development; negative regulation of protein localization to plasma membrane; and protein autoubiquitination.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
