-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADAM22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 223-400 of human ADAM22 (NP_004185.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADAM22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 223-400 of human ADAM22 (NP_004185.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01196A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADAM22 |
| Target Synonyms | MDC2; DEE61; EIEE61; ADAM 22; ADAM22 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, Mouse brain, Rat kidney, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 223-400 of human ADAM22 (NP_004185.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKRQLRRYPRNVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSG | Uniprot ID | Q9P0K1 |
Uniprot Id
Q9P0K1
Target Species
Human
Target Name
ADAM22
Target Full Name
Disintegrin and metalloproteinase domain-containing protein 22
Target Function
Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation. Neuronal receptor for LGI1.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell projection, axon.
Target Tissue Specificity
Highly expressed in the brain and in some high-grade but not low-grade gliomas. Detected slightly or not at all in other tissues.
Target Synonyms
A disintegrin and metalloproteinase domain 22; ADA22_HUMAN; ADAM 22; ADAM metallopeptidase domain 22; adam22; and cysteine-rich protein 2; Disintegrin and metalloproteinase domain-containing protein 22; disintegrin-like; MDC 2; MDC2; Metalloproteinase disintegrin ADAM22 3; Metalloproteinase like disintegrin like and cysteine rich protein 2; Metalloproteinase-disintegrin ADAM22-3; Metalloproteinase-like; MGC149832
Target Background
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. Unlike other members of the ADAM protein family, the protein encoded by this gene lacks metalloprotease activity since it has no zinc-binding motif. This gene is highly expressed in the brain and may function as an integrin ligand in the brain. In mice, it has been shown to be essential for correct myelination in the peripheral nervous system. Alternative splicing results in several transcript variants.
Notification