Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRKAR1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-290 of human PRKAR1B (NP_002726.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PRKAR1B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 190-290 of human PRKAR1B (NP_002726.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01273A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRKAR1B |
| Target Synonyms | MASNS; PRKAR1; PRKAR1B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, BT-474, HepG2, Jurkat, Mouse brain, Mouse lung, Rat testis, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 190-290 of human PRKAR1B (NP_002726.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGD | Uniprot ID | P31321 |
Uniprot Id
P31321
Target Species
Human
Target Name
PRKAR1B
Target Full Name
cAMP-dependent protein kinase type I-beta regulatory subunit
Target Function
Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells.
Target Subcellular Location
Cell membrane.
Target Protein Families
CAMP-dependent kinase regulatory chain family
Target Tissue Specificity
Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
Target Synonyms
cAMP dependent protein kinase type I beta regulatory subunit; cAMP-dependent protein kinase type I-beta regulatory subunit; KAP1_HUMAN; PKARI beta; PRKAR 1; PRKAR 1B; PRKAR1; Prkar1b; PRKAR1B protein; Protein kinase cAMP dependent regulatory type I beta; RIbeta
Target Background
The protein encoded by this gene is a regulatory subunit of cyclic AMP-dependent protein kinase A (PKA), which is involved in the signaling pathway of the second messenger cAMP. Two regulatory and two catalytic subunits form the PKA holoenzyme, disbands after cAMP binding. The holoenzyme is involved in many cellular events, including ion transport, metabolism, and transcription. Several transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
