-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC9A9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human SLC9A9 (NP_775924.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC9A9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human SLC9A9 (NP_775924.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01516A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC9A9 |
| Target Synonyms | NHE9; AUTS16; SLC9A9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, A-549, SH-SY5Y, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human SLC9A9 (NP_775924.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MERQSRVMSEKDEYQFQHQGAVELLVFNFLLILTILTIWLFKNHRFRFLHETGGAMVYGLIMGLILRYATAPTDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAILEKMTFD | Uniprot ID | Q8IVB4 |
Uniprot Id
Q8IVB4
Target Species
Human
Target Name
SLC9A9
Target Full Name
Sodium/hydrogen exchanger 9
Target Function
May act in electroneutral exchange of protons for Na(+) across membranes. Involved in the effusion of Golgi luminal H(+) in exchange for cytosolic cations. Involved in organelle ion homeostasis by contributing to the maintenance of the unique acidic pH values of the Golgi and post-Golgi compartments in the cell.
Target Involvement
Autism 16 (AUTS16)
Target Subcellular Location
Late endosome membrane; Multi-pass membrane protein.
Target Protein Families
Monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family
Target Tissue Specificity
Ubiquitously expressed in all tissues tested. Expressed at highest levels in heart and skeletal muscle, followed by placenta, kidney, and liver. Expressed in the brain, in the medulla and spinal cord.
Target Synonyms
5730527A11Rik; 9930105B05; AI854429; FLJ35613; Na(+)/H(+) exchanger 9; Nbla00118; NHE 9; NHE-9; NHE9; Putative protein product of Nbla00118; SL9A9_HUMAN; Slc9a9; Sodium/hydrogen exchanger 9; Sodium/proton exchanger NHE9; Solute carrier family 9 (sodium/hydrogen exchanger) isoform 9; Solute carrier family 9 (sodium/hydrogen exchanger) member 9; Solute carrier family 9 member 9
Target Background
This gene encodes a sodium/proton exchanger that is a member of the solute carrier 9 protein family. The encoded protein localizes the to the late recycling endosomes and may play an important role in maintaining cation homeostasis. Mutations in this gene are associated with autism susceptibility 16 and attention-deficit/hyperactivity disorder.
Notification