-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FCRL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-720 of human FCRL3 (NP_443171.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FCRL3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-720 of human FCRL3 (NP_443171.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01534A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FCRL3 |
| Target Synonyms | MAIA; FCRH3; IFGP3; IRTA3; SPAP2; CD307c; FCRL3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, B cells, Raji, Rat kidney, U-937 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 600-720 of human FCRL3 (NP_443171.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEE | Uniprot ID | Q96P31 |
Uniprot Id
Q96P31
Target Species
Human
Target Name
FCRL3
Target Full Name
Fc receptor-like protein 3
Target Function
Promotes TLR9-induced B-cell proliferation, activation and survival but inhibits antibody production and suppresses plasma cell differentiation. Enhances activation of NF-kappa-B and MAPK signaling pathways in TLR9 stimulated B-cells. Has inhibitory potentional on B-cell receptor (BCR)-mediated signaling, possibly through association with SH2 domain-containing phosphatases. Inhibits cell tyrosine phosphorylation, calcium mobilization and activation-induced cell death induced through BCR signaling. Regulatory T-cells expressing FCRL3 exhibit a memory phenotype, are relatively nonresponsive to antigenic stimulation in presence of IL2 and have reduced capacity to suppress the proliferation of effector T-cells.
Target Involvement
Rheumatoid arthritis (RA)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Low expression on transitional B cells which increases to higher surface expression on mature and memory B-cells with innate-like features (at protein level). Expressed a low
Target Research Area
Others
Target Synonyms
CD307c; Fc receptor homolog 3; Fc receptor-like protein 3; FcR-like protein 3; FcRH3; FcRL3; FCRL3_HUMAN; hIFGP3; IFGP family protein 3; IFGP3; Immune receptor translocation-associated protein 3; Immunoglobulin superfamily receptor translocation associated protein 3; IRTA3; SH2 domain-containing phosphatase anchor protein 2; SPAP2
Target Background
This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
Notification