Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MARCH9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 277-346 of human MARCH9 (NP_612405.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MARCH9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 277-346 of human MARCH9 (NP_612405.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01653A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | 9-Mar |
| Target Synonyms | MARCH9; RNF179; MARCH-IX | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 277-346 of human MARCH9 (NP_612405.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV | Uniprot ID | Q86YJ5 |
Uniprot Id
Q86YJ5
Target Species
Human
Target Name
MARCHF9
Target Full Name
E3 ubiquitin-protein ligase MARCHF9
Target Function
E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I, CD4 and ICAM1, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein.
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
MARCHF9; MARCH9; RNF179; E3 ubiquitin-protein ligase MARCHF9; Membrane-associated RING finger protein 9; Membrane-associated RING-CH protein IX; MARCH-IX; RING finger protein 179; RING-type E3 ubiquitin transferase MARCHF9
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
