Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human UBA2 (NP_005490.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human UBA2 (NP_005490.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01723A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBA2 |
| Target Synonyms | ARX; SAE2; ACCES; HRIHFB2115; UBA2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human UBA2 (NP_005490.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QFLFQKKHVGRSKAQVAKESVLQFYPKANIVAYHDSIMNPDYNVEFFRQFILVMNALDNRAARNHVNRMCLAADVPLIESGTAGYLGQVTTIKKGVTECYE | Uniprot ID | Q9UBT2 |
Uniprot Id
Q9UBT2
Target Species
Human
Target Name
UBA2
Target Full Name
SUMO-activating enzyme subunit 2
Target Function
The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Shuttles between the cytoplasm and the nucleus, sumoylation is required either for nuclear translocation or nuclear retention.
Target Protein Families
Ubiquitin-activating E1 family
Target Research Area
Cell Biology
Target Synonyms
Anthracycline associated resistance ARX; Anthracycline-associated resistance ARX; ARX; FLJ13058; HRIHFB2115; SAE 2; SAE2; SAE2_HUMAN; SUMO 1 activating enzyme subunit 2; SUMO activating enzyme subunit 2; SUMO-activating enzyme subunit 2; UBA2; UBA2 ubiquitin activating enzyme E1 homolog; Ubiquitin like 1 activating enzyme E1B; Ubiquitin like modifier activating enzyme 2; Ubiquitin-like 1-activating enzyme E1B; UBLE1B
Target Background
Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 (MIM 613294) and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
