-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TET3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1551-1650 of human TET3 (NP_001274420.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TET3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1551-1650 of human TET3 (NP_001274420.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01847A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TET3 |
| Target Synonyms | BEFAHRS; hCG_40738; TET3 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | mESCs | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1551-1650 of human TET3 (NP_001274420.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GFQDKLWNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNFLDEN | Uniprot ID | O43151 |
Uniprot Id
O43151
Target Species
Human
Target Name
TET3
Target Full Name
Methylcytosine dioxygenase TET3
Target Function
Dioxygenase that catalyzes the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC) and plays a key role in epigenetic chromatin reprogramming in the zygote following fertilization. Also mediates subsequent conversion of 5hmC into 5-formylcytosine (5fC), and conversion of 5fC to 5-carboxylcytosine (5caC). Conversion of 5mC into 5hmC, 5fC and 5caC probably constitutes the first step in cytosine demethylation. Selectively binds to the promoter region of target genes and contributes to regulate the expression of numerous developmental genes. In zygotes, DNA demethylation occurs selectively in the paternal pronucleus before the first cell division, while the adjacent maternal pronucleus and certain paternally-imprinted loci are protected from this process. Participates in DNA demethylation in the paternal pronucleus by mediating conversion of 5mC into 5hmC, 5fC and 5caC. Does not mediate DNA demethylation of maternal pronucleus because of the presence of DPPA3/PGC7 on maternal chromatin that prevents TET3-binding to chromatin. In addition to its role in DNA demethylation, also involved in the recruitment of the O-GlcNAc transferase OGT to CpG-rich transcription start sites of active genes, thereby promoting histone H2B GlcNAcylation by OGT. Binds preferentially to DNA containing cytidine-phosphate-guanosine (CpG) dinucleotides over CpH (H=A, T, and C), hemimethylated-CpG and hemimethylated-hydroxymethyl-CpG.
Target Subcellular Location
Nucleus. Cytoplasm. Chromosome.
Target Protein Families
TET family
Target Tissue Specificity
Expressed in colon, muscle, adrenal gland and peripheral blood lymphocytes.
Target Synonyms
hCG_40738; KIAA0401; Methylcytosine dioxygenase TET3; Probable methylcytosine dioxygenase TET3; Tet methylcytosine dioxygenase 3; Tet oncogene family member 3; Tet3; TET3_HUMAN
Target Background
Enables methyl-CpG binding activity and zinc ion binding activity. Involved in histone H3-K4 trimethylation; positive regulation of transcription by RNA polymerase II; and protein O-linked glycosylation. Predicted to be located in cytoplasm and male pronucleus. Predicted to be active in nucleus. Biomarker of esophagus squamous cell carcinoma.
Notification