-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLC gamma 1 (PLCG1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human PLC gamma 1 (PLCG1) (NP_002651.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLC gamma 1 (PLCG1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 700-800 of human PLC gamma 1 (PLCG1) (NP_002651.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01970A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLC gamma 1 (PLCG1) |
| Target Synonyms | PLC1; NCKAP3; PLC-II; PLC148; PLCgamma1; PLC gamma 1 (PLCG1) | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, MCF7 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 700-800 of human PLC gamma 1 (PLCG1) (NP_002651.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALF | Uniprot ID | P19174 |
Uniprot Id
P19174
Target Species
Human
Target Name
PLCG1
Target Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
Target Function
Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades. Becomes activated in response to ligand-mediated activation of receptor-type tyrosine kinases, such as PDGFRA, PDGFRB, EGFR, FGFR1, FGFR2, FGFR3 and FGFR4. Plays a role in actin reorganization and cell migration.
Target Subcellular Location
Cell projection, lamellipodium. Cell projection, ruffle.
Target Synonyms
1 phosphatidyl D myo inositol 4 5 bisphosphate ; 1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase gamma 1; 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-1; Inositoltrisphosphohydrolase; Monophosphatidylinositol phosphodiesterase; NCKAP3; Phosphatidylinositol phospholipase C; Phosphoinositidase C; Phosphoinositide phospholipase C; Phosphoinositide phospholipase C-gamma-1; Phospholipase C 148; Phospholipase C gamma 1; Phospholipase C-gamma-1; Phospholipase C-II; PLC gamma 1; PLC II; PLC-148; PLC-gamma-1; PLC-II; PLC1; PLC148; Plcg1; PLCG1_HUMAN; PLCgamma1
Target Background
The protein encoded by this gene catalyzes the formation of inositol 1, 4, 5-trisphosphate and diacylglycerol from phosphatidylinositol 4, 5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of receptor-mediated tyrosine kinase activators. For example, when activated by SRC, the encoded protein causes the Ras guanine nucleotide exchange factor RasGRP1 to translocate to the Golgi, where it activates Ras. Also, this protein has been shown to be a major substrate for heparin-binding growth factor 1 (acidic fibroblast growth factor)-activated tyrosine kinase. Two transcript variants encoding different isoforms have been found for this gene.
Notification