Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MC3R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human MC3R (NP_063941.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MC3R was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human MC3R (NP_063941.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01982A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MC3R |
| Target Synonyms | MC3; OB20; OQTL; BMIQ9; MC3-R; MC3R | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human MC3R (NP_063941.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF | Uniprot ID | P41968 |
Uniprot Id
P41968
Target Species
Human
Target Name
MC3R
Target Full Name
Melanocortin receptor 3
Target Function
Receptor for MSH (alpha, beta and gamma) and ACTH. This receptor is mediated by G proteins which activate adenylate cyclase. Required for expression of anticipatory patterns of activity and wakefulness during periods of limited nutrient availability and for the normal regulation of circadian clock activity in the brain.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Brain, placental, and gut tissues.
Target Research Area
Cardiovascular
Target Synonyms
MC3R; Melanocortin receptor 3; MC3-R
Target Background
This gene encodes a G-protein-coupled receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone that is expressed in tissues other than the adrenal cortex and melanocytes. This gene maps to the same region as the locus for benign neonatal epilepsy. Mice deficient for this gene have increased fat mass despite decreased food intake, suggesting a role for this gene product in the regulation of energy homeostasis. Mutations in this gene are associated with a susceptibility to obesity in humans.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
