-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHMP1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human CHMP1A (NP_002759.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHMP1A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human CHMP1A (NP_002759.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01991A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHMP1A |
| Target Synonyms | PCH8; CHMP1; PRSM1; PCOLN3; VPS46A; VPS46-1; CHMP1A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 22Rv1, 293T, HT-29, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-196 of human CHMP1A (NP_002759.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN | Uniprot ID | Q9HD42 |
Uniprot Id
Q9HD42
Target Species
Human
Target Name
CHMP1A
Target Full Name
Charged multivesicular body protein 1a
Target Function
Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in cytokinesis. Involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells. May also be involved in chromosome condensation. Targets the Polycomb group (PcG) protein BMI1/PCGF4 to regions of condensed chromatin. May play a role in stable cell cycle progression and in PcG gene silencing.
Target Involvement
Pontocerebellar hypoplasia 8 (PCH8)
Target Subcellular Location
Cytoplasm. Endosome membrane; Peripheral membrane protein. Nucleus matrix. Note=The cytoplasmic form is partially membrane-associated and localizes to early endosomes. The nuclear form remains associated with the chromosome scaffold during mitosis. On overexpression, it localizes to nuclear bodies characterized by nuclease-resistant condensed chromatin.
Target Protein Families
SNF7 family
Target Tissue Specificity
Expressed in placenta, cultured skin fibroblasts and in osteoblast cell line MG-63.
Target Synonyms
Charged multivesicular body protein 1a; CHM1A_HUMAN; CHMP1a; Chromatin modifying protein 1a; Chromatin-modifying protein 1a; hVps46 1; hVps46-1; KIAA0047; Metalloprotease 1; PCOLN3; Procollagen (type III) N endopeptidase; PRSM1; Vacuolar protein sorting 46 1; Vacuolar protein sorting-associated protein 46-1; Vps46 1; Vps46-1
Target Background
This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes. The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase. The nomenclature has been updated recently to reflect the correct biological function of this encoded protein. Several transcripts encoding different isoforms have been found for this gene.
Notification