-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PIM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 247-326 of human PIM3 (NP_001001852.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PIM3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 247-326 of human PIM3 (NP_001001852.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02071A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PIM3 |
| Target Synonyms | pim-3; PIM3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SKOV3, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 247-326 of human PIM3 (NP_001001852.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL | Uniprot ID | Q86V86 |
Uniprot Id
Q86V86
Target Species
Human
Target Name
PIM3
Target Full Name
Serine/threonine-protein kinase pim-3
Target Function
Proto-oncogene with serine/threonine kinase activity that can prevent apoptosis, promote cell survival and protein translation. May contribute to tumorigenesis through: the delivery of survival signaling through phosphorylation of BAD which induces release of the anti-apoptotic protein Bcl-X(L), the regulation of cell cycle progression, protein synthesis and by regulation of MYC transcriptional activity. Additionally to this role on tumorigenesis, can also negatively regulate insulin secretion by inhibiting the activation of MAPK1/3 (ERK1/2), through SOCS6. Involved also in the control of energy metabolism and regulation of AMPK activity in modulating MYC and PPARGC1A protein levels and cell growth.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, PIM subfamily
Target Tissue Specificity
Detected in various tissues, including the heart, brain, lung, kidney, spleen, placenta, skeletal muscle, and peripheral blood leukocytes. Not found or barely expressed in the normal adult endoderm-derived organs such as colon, thymus, liver, or small int
Target Synonyms
Kid 1; Kid1; Kinase induced by depolarization; ONCOGENE PIM3; PIM 3; Pim 3 oncogene; Pim-3 proto-oncogene; serine/threonine kinase; PIM3; Pim3 oncogene; PIM3_HUMAN; Protein kinase Kid 1; Protein kinase Kid1; Serine/threonine kinase Pim 3 ; Serine/threonine kinase Pim3 ; Serine/threonine protein kinase Pim 3; Serine/threonine protein kinase Pim3; Serine/threonine-protein kinase Pim-3
Target Background
The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is overexpressed in hematological and epithelial tumors and is associated with MYC coexpression. It plays a role in the regulation of signal transduction cascades, contributing to both cell proliferation and survival, and provides a selective advantage in tumorigenesis.
Notification