-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DVL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human DVL2 (NP_004413.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against DVL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human DVL2 (NP_004413.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-02434A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DVL2 |
| Target Synonyms | DVL2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human DVL2 (NP_004413.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRGSTGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPG | Uniprot ID | O14641 |
Uniprot Id
O14641
Target Species
Human
Target Name
DVL2
Target Full Name
Segment polarity protein dishevelled homolog DVL-2
Target Function
Plays a role in the signal transduction pathways mediated by multiple Wnt genes. Participates both in canonical and non-canonical Wnt signaling by binding to the cytoplasmic C-terminus of frizzled family members and transducing the Wnt signal to down-stream effectors. Promotes internalization and degradation of frizzled proteins upon Wnt signaling.
Target Subcellular Location
Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol. Cytoplasmic vesicle. Nucleus.
Target Protein Families
DSH family
Target Synonyms
Dishevelled 2 (homologous to Drosophila dsh); Dishevelled dsh homolog 2; dishevelled segment polarity protein 2; Dishevelled-2; Dishevelled2; DSH homolog 2; DVL 2; Dvl2; DVL2_HUMAN; Segment polarity protein dishevelled homolog DVL 2; Segment polarity protein dishevelled homolog DVL-2; Segment polarity protein dishevelled homolog DVL2
Target Background
This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40% amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.
Notification