-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HAND2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 151-217 of human HAND2 (NP_068808.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against HAND2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 151-217 of human HAND2 (NP_068808.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02720A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HAND2 |
| Target Synonyms | Hed; dHand; DHAND2; Thing2; bHLHa26; HAND2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 151-217 of human HAND2 (NP_068808.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ | Uniprot ID | P61296 |
Uniprot Id
P61296
Target Species
Human
Target Name
HAND2
Target Full Name
Heart- and neural crest derivatives-expressed protein 2
Target Function
Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3'.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Heart.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
AI225906; AI661148 ; autonomic nervous system and neural crest derivatives-expressed protein 2; Basic helix loop helix transcription factor HAND2; bHLHa26; Class A basic helix-loop-helix protein 26; Deciduum; Deciduum heart autonomic nervous system and neural crest derivatives expressed protein 2; DHAND 2; dHAND; DHAND2; Ehand 2; Ehand2; FLJ16260; HAND 2; Hand2; HAND2_HUMAN; Heart and neural crest derivatives expressed 2; Heart and neural crest derivatives expressed protein 2; heart and neural crest derivatives expressed transcript 2; heart; Heart- and neural crest derivatives-expressed protein 2; Hed; Highly similar to dHAND M musculus; MGC125303; MGC125304; Th 2; Th2; Thing 2; Thing2
Target Background
The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development.
Notification