-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GM2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-193 of human GM2A (NP_000396.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GM2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 24-193 of human GM2A (NP_000396.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02932A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GM2A |
| Target Synonyms | GM2AP; SAP-3; GM2-AP; GM2A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 24-193 of human GM2A (NP_000396.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI | Uniprot ID | P17900 |
Uniprot Id
P17900
Target Species
Human
Target Name
GM2A
Target Full Name
Ganglioside GM2 activator
Target Function
The large binding pocket can accommodate several single chain phospholipids and fatty acids, GM2A also exhibits some calcium-independent phospholipase activity. Binds gangliosides and stimulates ganglioside GM2 degradation. It stimulates only the breakdown of ganglioside GM2 and glycolipid GA2 by beta-hexosaminidase A. It extracts single GM2 molecules from membranes and presents them in soluble form to beta-hexosaminidase A for cleavage of N-acetyl-D-galactosamine and conversion to GM3. Has cholesterol transfer activity.
Target Involvement
GM2-gangliosidosis AB (GM2GAB)
Target Subcellular Location
Lysosome.
Target Research Area
Metabolism, Signal Transduction
Target Synonyms
Cerebroside sulfate activator protein; ganglioside GM2 activator; Ganglioside GM2 activator isoform short; Ganglioside GM2 activator precursor; GM2 activator; GM2 AP; GM2 ganglioside activator; GM2 ganglioside activator protein; GM2-AP; GM2A; GM2AP; OTTHUMP00000160619; SAP 3; SAP-3; SAP3; SAP3_HUMAN; Shingolipid activator protein 3; Sphingolipid activator protein 3
Target Background
This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. Alternative splicing results in multiple transcript variants.
Notification