-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTGDR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-359 of human PTGDR (NP_000944.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTGDR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-359 of human PTGDR (NP_000944.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03305A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTGDR |
| Target Synonyms | DP; AS1; DP1; ASRT1; PTGDR1; PTGDR | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-359 of human PTGDR (NP_000944.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GAMRNLYAMHRRLQRHPRSCTRDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTSEEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL | Uniprot ID | Q13258 |
Uniprot Id
Q13258
Target Species
Human
Target Name
PTGDR
Target Full Name
Prostaglandin D2 receptor
Target Function
Receptor for prostaglandin D2 (PGD2). The activity of this receptor is mainly mediated by G(s) proteins that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP. A mobilization of calcium is also observed, but without formation of inositol 1,4,5-trisphosphate. Involved in PLA2G3-dependent maturation of mast cells. PLA2G3 is secreted by immature mast cells and acts on nearby fibroblasts upstream to PTDGS to synthesize PGD2, which in turn promotes mast cell maturation and degranulation via PTGDR.
Target Involvement
Asthma-related traits 1 (ASRT1)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in retinal choroid, ciliary epithelium, longitudinal and circular ciliary muscles, iris, small intestine and platelet membranes.
Target Research Area
Signal Transduction
Target Synonyms
PTGDR; Prostaglandin D2 receptor; PGD receptor; PGD2 receptor; Prostanoid DP receptor
Target Background
This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein is reported to be a receptor for prostaglandin D2, which is a mediator of allergic inflammation and allergic airway inflammation in asthma. Alternative splicing results in multiple transcript variants.
Notification