Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PATL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 535-640 of human PATL1 (NP_689929.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PATL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 535-640 of human PATL1 (NP_689929.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03480A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PATL1 |
| Target Synonyms | Pat1b; hPat1b; PATL1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 535-640 of human PATL1 (NP_689929.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DVEDYERRYLLSLEEERPALMDDRKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADILMTTARNLPFLIKKDAQDEVLPCLLSPF | Uniprot ID | Q86TB9 |
Uniprot Id
Q86TB9
Target Species
Human
Target Name
PATL1
Target Full Name
Protein PAT1 homolog 1
Target Function
RNA-binding protein involved in deadenylation-dependent decapping of mRNAs, leading to the degradation of mRNAs. Acts as a scaffold protein that connects deadenylation and decapping machinery. Required for cytoplasmic mRNA processing body (P-body) assembly.; (Microbial infection) In case of infection, required for translation and replication of hepatitis C virus (HCV).
Target Subcellular Location
Cytoplasm, P-body. Nucleus. Nucleus, PML body. Nucleus speckle.
Target Protein Families
PAT1 family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
hPat1b; OK/KNS-cl.5; PAT1-like protein 1; Pat1b; PATL1; PATL1_HUMAN; protein associated with topoisomerase II homolog 1 ; Protein PAT1 homolog 1; Protein PAT1 homolog b
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
