-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MSH3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 617-761 of human MSH3 (NP_004696.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MSH3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 617-761 of human MSH3 (NP_004696.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03717A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MSH3 |
| Target Synonyms | DUP; FAP4; MRP1; MSH3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SW620 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 617-761 of human MSH3 (NP_004696.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT | Uniprot ID | P20585 |
Uniprot Id
P20585
Target Species
Human
Target Name
MSH3
Target Full Name
DNA mismatch repair protein Msh3
Target Function
Component of the post-replicative DNA mismatch repair system (MMR). Heterodimerizes with MSH2 to form MutS beta which binds to DNA mismatches thereby initiating DNA repair. When bound, the MutS beta heterodimer bends the DNA helix and shields approximately 20 base pairs. MutS beta recognizes large insertion-deletion loops (IDL) up to 13 nucleotides long. After mismatch binding, forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis.
Target Involvement
Endometrial cancer (ENDMC); Familial adenomatous polyposis 4 (FAP4)
Target Protein Families
DNA mismatch repair MutS family, MSH3 subfamily
Target Synonyms
Divergent upstream protein; DNA mismatch repair protein; DNA mismatch repair protein Msh 3; DNA mismatch repair protein MSH3; DUC 1; DUC1; DUG; DUP; hMSH3; MGC163306; MGC163308; Mismatch repair protein 1; MRP 1; MRP1; MSH 3; MSH3; MSH3_HUMAN; MutS homolog 3 (E. coli); MutS homolog 3
Target Background
The protein encoded by this gene forms a heterodimer with MSH2 to form MutS beta, part of the post-replicative DNA mismatch repair system. MutS beta initiates mismatch repair by binding to a mismatch and then forming a complex with MutL alpha heterodimer. This gene contains a polymorphic 9 bp tandem repeat sequence in the first exon. The repeat is present 6 times in the reference genome sequence and 3-7 repeats have been reported. Defects in this gene are a cause of susceptibility to endometrial cancer.
Notification