-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE2D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D1 (NP_003329.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against UBE2D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D1 (NP_003329.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-04448A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE2D1 |
| Target Synonyms | SFT; UBCH5; UBC4/5; UBCH5A; E2(17)KB1; UBE2D1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, SW620 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human UBE2D1 (NP_003329.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM | Uniprot ID | P51668 |
Uniprot Id
P51668
Target Species
Human
Target Name
UBE2D1
Target Full Name
Ubiquitin-conjugating enzyme E2 D1
Target Function
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and auto-ubiquitination of STUB1, TRAF6 and TRIM63/MURF1. Ubiquitinates STUB1-associated HSP90AB1 in vitro. Lacks inherent specificity for any particular lysine residue of ubiquitin. Essential for viral activation of IRF3. Mediates polyubiquitination of CYP3A4.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Ubiquitin-conjugating enzyme family
Target Tissue Specificity
Ubiquitous. Up-regulated in livers of iron-overloaded patients with hereditary hemochromatosis.
Target Synonyms
E2(17)KB1; SFT; Stimulator of Fe transport; UB2D1_HUMAN; UBC 4/5; UBC4/5; UBC4/5 homolog; UBC4/5, S. cerevisiae, homolog of; UBCH 5; UBCH 5A; UbcH5; UBCH5A; Ube2d1; Ubiquitin carrier protein; Ubiquitin carrier protein D1; Ubiquitin conjugating enzyme E2 17 kDa 1; Ubiquitin conjugating enzyme E2 D1; Ubiquitin conjugating enzyme E2D 1 (UBC4/5 homolog yeast); Ubiquitin conjugating enzyme E2D 1; Ubiquitin conjugating enzyme UBCH5A; Ubiquitin protein ligase D1; Ubiquitin-conjugating enzyme E2 D1; Ubiquitin-conjugating enzyme E2(17)KB 1; Ubiquitin-conjugating enzyme E2-17 kDa 1; Ubiquitin-protein ligase D1
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is closely related to a stimulator of iron transport (SFT), and is up-regulated in hereditary hemochromatosis. It also functions in the ubiquitination of the tumor-suppressor protein p53 and the hypoxia-inducible transcription factor HIF1alpha by interacting with the E1 ubiquitin-activating enzyme and the E3 ubiquitin-protein ligases. Two transcript variants encoding different isoforms have been found for this gene.
Notification