-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IL10RA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-410 of human IL10RA. (NP_001549.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against IL10RA was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 265-410 of human IL10RA. (NP_001549.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04490A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IL10RA |
| Target Synonyms | CD210; IL10R; CD210a; CDW210A; HIL-10R; IL-10R1; IL10RA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 265-410 of human IL10RA. (NP_001549.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSE | Uniprot ID | Q13651 |
Uniprot Id
Q13651
Target Species
Human
Target Name
IL10RA
Target Full Name
Interleukin-10 receptor subunit alpha
Target Function
Cell surface receptor for the cytokine IL10 that participates in IL10-mediated anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Upon binding to IL10, induces a conformational change in IL10RB, allowing IL10RB to bind IL10 as well. In turn, the heterotetrameric assembly complex, composed of two subunits of IL10RA and IL10RB, activates the kinases JAK1 and TYK2 that are constitutively associated with IL10RA and IL10RB respectively. These kinases then phosphorylate specific tyrosine residues in the intracellular domain in IL10RA leading to the recruitment and subsequent phosphorylation of STAT3. Once phosphorylated, STAT3 homodimerizes, translocates to the nucleus and activates the expression of anti-inflammatory genes. In addition, IL10RA-mediated activation of STAT3 inhibits starvation-induced autophagy.
Target Involvement
Inflammatory bowel disease 28 (IBD28)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cytoplasm.
Target Protein Families
Type II cytokine receptor family
Target Tissue Specificity
Primarily expressed in hematopoetic cells including B-cells, T-cells, NK cells, monocytes and macrophages. Not expressed in non-hematopoetic cells such as fibroblasts or endothelial cells.
Target Research Area
Immunology
Target Synonyms
CD210; CDw210a; CDw210a antigen; HIL 10R; HIL10R; I10R1_HUMAN; IL 10R 1; IL 10R A; IL 10R; IL 10R1; IL-10 receptor subunit alpha; IL-10R subunit 1; IL-10R subunit alpha; IL-10R1; IL-10RA; IL10R; IL10R1; IL10RA; Interleukin 10 receptor alpha; Interleukin 10 receptor alpha chain; Interleukin-10 receptor subunit 1; Interleukin-10 receptor subunit alpha
Target Background
The protein encoded by this gene is a receptor for interleukin 10. This protein is structurally related to interferon receptors. It has been shown to mediate the immunosuppressive signal of interleukin 10, and thus inhibits the synthesis of proinflammatory cytokines. This receptor is reported to promote survival of progenitor myeloid cells through the insulin receptor substrate-2/PI 3-kinase/AKT pathway. Activation of this receptor leads to tyrosine phosphorylation of JAK1 and TYK2 kinases. Two transcript variants, one protein-coding and the other not protein-coding, have been found for this gene.
Notification