Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DEFB4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-64 of human DEFB4A (NP_004933.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against DEFB4A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-64 of human DEFB4A (NP_004933.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded rat lung using DEFB4A antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
| Cat.No | ADA-04554A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DEFB4A |
| Target Synonyms | BD-2; SAP1; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102; DEFB4A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-64 of human DEFB4A (NP_004933.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP | Uniprot ID | O15263 |
Uniprot Id
O15263
Target Species
Human
Target Name
DEFB4A
Target Full Name
Defensin beta 4A
Target Function
Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells.
Target Subcellular Location
Secreted.
Target Protein Families
Beta-defensin family, LAP/TAP subfamily
Target Tissue Specificity
Expressed in the skin and respiratory tract.
Target Synonyms
BD 2; BD-2; BD2; beta 2; beta 2 Defensin; Beta defensin 2; Beta defensin 4B; Beta-defensin 2; Beta-defensin 4A; DEF B2; DEF B4; DEFB 102; DEFB 2; DEFB 4; DEFB102; DEFB2; DEFB2; formerly; DEFB4; DEFB4; formerly; DEFB4B; DEFB4P; Defensin; Defensin beta 2; Defensin; beta 4; Defensin; beta 4; pseudogene; Defensin; beta 4A; Defensin; beta 4B; Defensin; beta; 2; formerly; Defensin; beta; 4; formerly; DFB4A_HUMAN; HBD 2; hBD-2; HBD2; mBD-2; SAP 1; SAP1; Skin antimicrobial peptide 1; Skin-antimicrobial peptide 1
Target Background
Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
