-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRAF7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-400 of human TRAF7 (NP_115647.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TRAF7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-400 of human TRAF7 (NP_115647.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04748A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRAF7 |
| Target Synonyms | RFWD1; RNF119; CAFDADD; TRAF7 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 260-400 of human TRAF7 (NP_115647.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVW | Uniprot ID | Q6Q0C0 |
Uniprot Id
Q6Q0C0
Target Species
Human
Target Name
TRAF7
Target Full Name
E3 ubiquitin-protein ligase TRAF7
Target Function
E3 ubiquitin ligase capable of auto-ubiquitination, following phosphorylation by MAP3K3. Potentiates MAP3K3-mediated activation of the NF-kappa-B, JUN/AP1 and DDIT3 transcriptional regulators. Induces apoptosis when overexpressed. Plays a role in the phosphorylation of MAPK1 and/or MAPK3, probably via its interaction with MAP3K3.
Target Subcellular Location
Cytoplasmic vesicle. Note=Colocalizes with MAP3K3 to vesicle-like structures throughout the cytoplasm.
Target Protein Families
WD repeat TRAF7 family
Target Tissue Specificity
Ubiquitously expressed with high levels in skeletal muscle, heart, colon, spleen, kidney, liver and placenta.
Target Synonyms
E3 ubiquitin protein ligase TRAF7; E3 ubiquitin-protein ligase TRAF7; RFWD1; Ring finger and WD repeat domain 1; RING finger and WD repeat-containing protein 1; RING finger protein 119; RNF119; TNF receptor associated factor 7; TNF receptor-associated factor 7; TRAF7; TRAF7_HUMAN
Target Background
Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs; a coiled-coil (leucine zipper) motif; and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding.
Notification