-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TAF9B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF9B (NP_057059.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TAF9B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF9B (NP_057059.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04791A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TAF9B |
| Target Synonyms | DN7; DN-7; TAF9L; TAFII31L; TFIID-31; TAF9B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TAF9B (NP_057059.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGA | Uniprot ID | Q9HBM6 |
Uniprot Id
Q9HBM6
Target Species
Human
Target Name
TAF9B
Target Full Name
Transcription initiation factor TFIID subunit 9B
Target Function
Essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. May have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription.
Target Subcellular Location
Nucleus.
Target Protein Families
TAF9 family
Target Synonyms
DN-7; DN7; Neuronal cell death related protein 7; Neuronal cell death-related protein 7; TAF9-like RNA polymerase II TBP associated factor, 31 kD; Taf9b; TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa; TAF9B_HUMAN; TAF9L; TAFII31L; TFIID-31; Transcription initiation factor TFIID subunit 9-like; Transcription initiation factor TFIID subunit 9-like protein; Transcription initiation factor TFIID subunit 9B; Transcription-associated factor TAFII31L
Target Background
Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes a protein that is similar to one of the small subunits of TFIID, TBP-associated factor 9, and is also a subunit of TFIID. TAF9 and TAF9b share some functions but also have distinct roles in the transcriptional regulatory process.
Notification