Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLRA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-420 of human GLRA2 (NP_002054.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GLRA2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 350-420 of human GLRA2 (NP_002054.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04914A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLRA2 |
| Target Synonyms | GLR; MRXSP; GLRA2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, Mouse spinal cord, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 350-420 of human GLRA2 (NP_002054.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RLRRRQKRQNKEEDVTRESRFNFSGYGMGHCLQVKDGTAVKATPANPLPQPPKDGDAIKKKFVDRAKRIDT | Uniprot ID | P23416 |
Uniprot Id
P23416
Target Species
Human
Target Name
GLRA2
Target Full Name
Glycine receptor subunit alpha-2
Target Function
Glycine receptors are ligand-gated chloride channels. Channel opening is triggered by extracellular glycine. Channel opening is also triggered by taurine and beta-alanine. Plays a role in the down-regulation of neuronal excitability. Contributes to the generation of inhibitory postsynaptic currents. Plays a role in cellular responses to ethanol.
Target Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell junction, synapse. Cell membrane; Multi-pass membrane protein. Cell projection.
Target Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Glycine receptor (TC 1.A.9.3) subfamily, GLRA2 sub-subfamily
Target Synonyms
GLR; Glra2; GLRA2_HUMAN; Glycine receptor alpha 2 polypeptide; Glycine receptor alpha 2 subunit; Glycine receptor subunit alpha 2; Glycine receptor subunit alpha-2; Gycine receptor alpha 2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
