Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HPCAL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human HPCAL4 (NP_057341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HPCAL4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human HPCAL4 (NP_057341.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05049A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HPCAL4 |
| Target Synonyms | HLP4; HPCAL4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, LO2, Mouse brain, Mouse liver, Mouse testis, Rat brian, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-191 of human HPCAL4 (NP_057341.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLLQCDMQK | Uniprot ID | Q9UM19 |
Uniprot Id
Q9UM19
Target Species
Human
Target Name
HPCAL4
Target Full Name
Hippocalcin-like protein 4
Target Function
May be involved in the calcium-dependent regulation of rhodopsin phosphorylation.
Target Protein Families
Recoverin family
Target Synonyms
Hippocalcin like 4; Hippocalcin like protein 4; Hippocalcin-like protein 4; HLP4; HPCAL4; HPCL4_HUMAN; OTTHUMP00000010835
Target Background
The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. The transcript of this gene has multiple polyadenylation sites. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
