-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Sec23B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human Sec23B (NP_006354.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Sec23B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human Sec23B (NP_006354.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05257A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEC23B |
| Target Synonyms | CWS7; CDAII; CDAN2; CDA-II; HEMPAS; hSec23B; Sec23B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Raji | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Sec23B (NP_006354.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SLQMSLSLLPPDALVGLITFGRMVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQ | Uniprot ID | Q15437 |
Uniprot Id
Q15437
Target Species
Human
Target Name
SEC23B
Target Full Name
Protein transport protein Sec23B
Target Function
Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules for their transport to the Golgi complex.
Target Involvement
Cowden syndrome 7 (CWS7); Anemia, congenital dyserythropoietic, 2 (CDAN2)
Target Subcellular Location
Cytoplasmic vesicle, COPII-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol.
Target Protein Families
SEC23/SEC24 family, SEC23 subfamily
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
CDA II; CDAII; CDAN2; HEMPAS; Protein transport protein Sec23B; RP11-379J5.1; SC23B_HUMAN; Sec23 homolog B (S. cerevisiae); SEC23 related protein B; SEC23-like protein B; SEC23-related protein B; Sec23b; Transport protein SEC23B
Target Background
The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function of this gene product has been implicated in cargo selection and concentration. Multiple alternatively spliced transcript variants have been identified in this gene.
Notification