Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTGFR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PTGFR (NP_000950.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTGFR was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PTGFR (NP_000950.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05281A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTGFR |
| Target Synonyms | FP; PTGFR | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PTGFR (NP_000950.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ILMKAYQRFRQKSKASFLLLASGLVITDFFGHLINGAIAVFVYASDKEWIRFDQSNVLCSIFGICMVFSGLCPLLLGSVMAIERCIGVTKPIFHSTKITSK | Uniprot ID | P43088 |
Uniprot Id
P43088
Target Species
Human
Target Name
PTGFR
Target Full Name
Prostaglandin F2-alpha receptor
Target Function
Receptor for prostaglandin F2-alpha (PGF2-alpha). The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system. Initiates luteolysis in the corpus luteum. Isoforms 2 to 7 do not bind PGF2-alpha but are proposed to modulate signaling by participating in variant receptor complexes; heterodimers between isoform 1 and isoform 5 are proposed to be a receptor for prostamides including the synthetic analog bimatoprost.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Eye.
Target Synonyms
PTGFR; Prostaglandin F2-alpha receptor; PGF receptor; PGF2-alpha receptor; Prostanoid FP receptor
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
