-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TELO2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human TELO2 (NP_057195.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TELO2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 450-550 of human TELO2 (NP_057195.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05315A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TELO2 |
| Target Synonyms | CLK2; TEL2; YHFS; TELO2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 450-550 of human TELO2 (NP_057195.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASEAGTSLVPATAEPPAETPAEIVDGGVPQAQLAGSDSDLDSDDEFVPYDMSGDRELKSSKAPAYVRDCVEALTTSEDIERWEAALRALEGLVYRSPTATR | Uniprot ID | Q9Y4R8 |
Uniprot Id
Q9Y4R8
Target Species
Human
Target Name
TELO2
Target Full Name
Telomere length regulation protein TEL2 homolog
Target Function
Regulator of the DNA damage response (DDR). Part of the TTT complex that is required to stabilize protein levels of the phosphatidylinositol 3-kinase-related protein kinase (PIKK) family proteins. The TTT complex is involved in the cellular resistance to DNA damage stresses, like ionizing radiation (IR), ultraviolet (UV) and mitomycin C (MMC). Together with the TTT complex and HSP90 may participate in the proper folding of newly synthesized PIKKs. Promotes assembly, stabilizes and maintains the activity of mTORC1 and mTORC2 complexes, which regulate cell growth and survival in response to nutrient and hormonal signals. May be involved in telomere length regulation.
Target Involvement
You-Hoover-Fong syndrome (YHFS)
Target Subcellular Location
Cytoplasm. Membrane. Nucleus. Chromosome, telomere.
Target Protein Families
TEL2 family
Target Synonyms
CLK2; hCLK2; KIAA0683; Protein clk-2 homolog; TEL2; TEL2 telomere maintenance 2 homolog; TEL2, telomere maintenance 2, homolog; telo2; TELO2_HUMAN; Telomere length regulation protein TEL2 homolog; Telomere maintenance 2
Target Background
This gene encodes a protein that functions as an S-phase checkpoint protein in the cell cycle. The protein may also play a role in DNA repair.
Notification