Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADAM32 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 703-787 of human ADAM32 (NP_659441.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ADAM32 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 703-787 of human ADAM32 (NP_659441.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05334A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADAM32 |
| Target Synonyms | ADAM32 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 703-787 of human ADAM32 (NP_659441.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARKQLKKWFAKEEEFPSSESKSEGSTQTYASQSSSEGSTQTYASQTRSESSSQADTSKSKSEDSAEAYTSRSKSQDSTQTQSSSN | Uniprot ID | Q8TC27 |
Uniprot Id
Q8TC27
Target Species
Human
Target Name
ADAM32
Target Full Name
Disintegrin and metalloproteinase domain-containing protein 32
Target Function
May play a role in sperm development and fertilization This is a non-catalytic metalloprotease-like protein.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Tissue Specificity
Testis specific.
Target Synonyms
ADAM32; UNQ5982/PRO21340; Disintegrin and metalloproteinase domain-containing protein 32; ADAM 32
Target Background
This gene encodes a member of the disintegrin family of membrane-anchored proteins that play a role in diverse biological processes such as brain development, fertilization, tumor development and inflammation. This gene is predominantly expressed in the testis. The encoded protein undergoes proteolytic processing to generate a mature polypeptide comprised of an metalloprotease, disintegrin and epidermal growth factor-like domains. This gene is located in a cluster of other disintegrin and metallopeptidase family genes on chromosome 8. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
