Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GPR6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 253-362 of human GPR6 (NP_005275.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GPR6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 253-362 of human GPR6 (NP_005275.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05480A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GPR6 |
| Target Synonyms | GPR6 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 253-362 of human GPR6 (NP_005275.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV | Uniprot ID | P46095 |
Uniprot Id
P46095
Target Species
Human
Target Name
GPR6
Target Full Name
G-protein coupled receptor 6
Target Function
Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Detected in the intracellular compartments. It is currently unclear whether this is a cell surface or intracellular receptor.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
GPR6; G-protein coupled receptor 6; Sphingosine 1-phosphate receptor GPR6
Target Background
Predicted to enable sphingosine-1-phosphate receptor activity. Predicted to be involved in adenylate cyclase-activating G protein-coupled receptor signaling pathway and regulation of metabolic process. Predicted to act upstream of or within positive regulation of cytosolic calcium ion concentration. Predicted to be integral component of plasma membrane. Predicted to be active in cytoplasm and plasma membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
