Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GNGT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human GNGT2 (NP_113686.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against GNGT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human GNGT2 (NP_113686.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05898A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GNGT2 |
| Target Synonyms | GNG9; HG3I; GNGT8; G-GAMMA-8; G-GAMMA-C; GNGT2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-69 of human GNGT2 (NP_113686.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS | Uniprot ID | O14610 |
Uniprot Id
O14610
Target Species
Human
Target Name
GNGT2
Target Full Name
Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
Target Function
Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
G protein gamma family
Target Tissue Specificity
Retinal cones.
Target Synonyms
GNGT2; GNG8; GNG9; GNGT8Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2; G gamma-C; G-gamma-8; G-gamma-9; Guanine nucleotide binding protein gamma transducing activity polypeptide 2
Target Background
Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
