Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MED22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human MED22 (NP_852468.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MED22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human MED22 (NP_852468.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-06009A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MED22 |
| Target Synonyms | SRB6; MED24; SURF5; surf-5; MED22 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, A-549, Mouse testis, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human MED22 (NP_852468.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK | Uniprot ID | Q15528 |
Uniprot Id
Q15528
Target Species
Human
Target Name
MED22
Target Full Name
Mediator of RNA polymerase II transcription subunit 22
Target Function
Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Target Subcellular Location
Nucleus.
Target Protein Families
Mediator complex subunit 22 family
Target Synonyms
MED22; SURF5Mediator of RNA polymerase II transcription subunit 22; Mediator complex subunit 22; Surfeit locus protein 5; Surf-5
Target Background
This gene encodes a protein component of the mediator complex, which functions in the regulation of transcription by bridging interactions between gene-specific regulatory factors, RNA polymerase II, and general transcription factors. Alternatively spliced transcript variants encoding different isoforms have been observed.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
