Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NXT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human NXT2 (NP_061168.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NXT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human NXT2 (NP_061168.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06010A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NXT2 |
| Target Synonyms | P15-2; NXT2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-180 of human NXT2 (NP_061168.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNT | Uniprot ID | Q9NPJ8 |
Uniprot Id
Q9NPJ8
Target Species
Human
Target Name
NXT2
Target Full Name
NTF2-related export protein 2
Target Function
Regulator of protein export for NES-containing proteins. Also plays a role in mRNA nuclear export.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Shuttles between the nucleus and the cytoplasm.
Target Synonyms
NTF2-related export protein 2; Nxt2; NXT2_HUMAN; Protein p15-2
Target Background
The protein encoded by this gene contains a nuclear transport factor 2 (NTF2) domain, which plays an important role in the trafficking of macromolecules, ions, and small molecules between the cytoplasm and nucleus. This protein may also have a role in mRNA nuclear export. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
