Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against KLF13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human KLF13 (NP_057079.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against KLF13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human KLF13 (NP_057079.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06130A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | KLF13 |
| Target Synonyms | BTEB3; FKLF2; NSLP1; RFLAT1; RFLAT-1; KLF13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, HepG2, Jurkat, K-562, Mouse lung, Mouse spleen, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human KLF13 (NP_057079.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPAPEPTSPGAEGAAAAPPSPAWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGKSSHLKAHLRTHTGERPFACS | Uniprot ID | Q9Y2Y9 |
Uniprot Id
Q9Y2Y9
Target Species
Human
Target Name
KLF13
Target Full Name
Krueppel-like factor 13
Target Function
Represses transcription by binding to the BTE site, a GC-rich DNA element, in competition with the activator SP1. It also represses transcription by interacting with the corepressor Sin3A and HDAC1. Activates RANTES expression in T-cells.
Target Subcellular Location
Nucleus.
Target Protein Families
Sp1 C2H2-type zinc-finger protein family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Basic transcription element binding protein 3; Basic transcription element-binding protein 3; BTE binding protein 3; BTE-binding protein 3; BTEB3; C2 H2 zinc finger protein; FKLF 2; FKLF2; Klf13; KLF13_HUMAN; Krueppel-like factor 13; Kruppel like factor 13; Novel Sp1 like zinc finger transcription factor ; Novel Sp1-like zinc finger transcription factor 1; NSLP1; RANTES factor of late activated T lymphocytes 1; RANTES factor of late activated T-lymphocytes 1; RFLAT 1; RFLAT-1; RFLAT1; Transcription factor BTEB3; Transcription factor NSLP1
Target Background
KLF13 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes (Scohy et al., 2000 [PubMed 11087666]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
