-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSMD10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 127-226 of human PSMD10 (NP_002805.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PSMD10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 127-226 of human PSMD10 (NP_002805.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06365A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSMD10 |
| Target Synonyms | p28; p28(GANK); dJ889N15.2; PSMD10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-549, Mouse lung, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 127-226 of human PSMD10 (NP_002805.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG | Uniprot ID | O75832 |
Uniprot Id
O75832
Target Species
Human
Target Name
PSMD10
Target Full Name
26S proteasome non-ATPase regulatory subunit 10
Target Function
Acts as a chaperone during the assembly of the 26S proteasome, specifically of the PA700/19S regulatory complex (RC). In the initial step of the base subcomplex assembly is part of an intermediate PSMD10:PSMC4:PSMC5:PAAF1 module which probably assembles with a PSMD5:PSMC2:PSMC1:PSMD2 module. Independently of the proteasome, regulates EGF-induced AKT activation through inhibition of the RHOA/ROCK/PTEN pathway, leading to prolonged AKT activation. Plays an important role in RAS-induced tumorigenesis.; Acts as an proto-oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4. Facilitates binding of MDM2 to p53/TP53 and the mono- and polyubiquitination of p53/TP53 by MDM2 suggesting a function in targeting the TP53:MDM2 complex to the 26S proteasome. Involved in p53-independent apoptosis. Involved in regulation of NF-kappa-B by retaining it in the cytoplasm. Binds to the NF-kappa-B component RELA and accelerates its XPO1/CRM1-mediated nuclear export.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Tissue Specificity
Tends to be up-regulated in cancer cells with RAS mutations, including lung cancers and adenocarconimas (at protein level).
Target Research Area
Cancer
Target Synonyms
26S proteasome non-ATPase regulatory subunit 10; 26S proteasome regulatory subunit p28; Ankyrin repeat protein; dJ889N15.2; Gankyrin; Hepatocellular carcinoma-associated protein p28 II; p28; p28(GANK); Proteasome (prosome, macropain) 26S subunit, non ATPase, 10; Proteasome 26S S10; PSD10_HUMAN; Psmd10
Target Background
This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.
Notification