-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NOTCH3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 751-850 of human NOTCH3 (NP_000426.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NOTCH3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 751-850 of human NOTCH3 (NP_000426.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-06495A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NOTCH3 |
| Target Synonyms | IMF2; LMNS; CASIL; CADASIL; CADASIL1; NOTCH3 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat skeletal muscle | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 751-850 of human NOTCH3 (NP_000426.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDGMGFHCTCPPGVQGRQCELLSPCTPNPCEHGGRCESAPGQLPVCSCPQGWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGGYTGPSCDQDI | Uniprot ID | Q9UM47 |
Uniprot Id
Q9UM47
Target Species
Human
Target Name
NOTCH3
Target Full Name
Neurogenic locus notch homolog protein 3
Target Function
Functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Affects the implementation of differentiation, proliferation and apoptotic programs.
Target Involvement
Cerebral arteriopathy, autosomal dominant, with subcortical infarcts and leukoencephalopathy, 1 (CADASIL1); Myofibromatosis, infantile 2 (IMF2); Lateral meningocele syndrome (LMNS)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Notch 3 intracellular domain]: Nucleus. Note=Following proteolytical processing NICD is translocated to the nucleus.
Target Protein Families
NOTCH family
Target Tissue Specificity
Ubiquitously expressed in fetal and adult tissues.
Target Synonyms
CADASIL; CASIL; NOTC3_HUMAN; Notch 3; Notch 3 intracellular domain; Notch homolog 3; Notch3
Target Background
This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).
Notification