Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SOSTDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 115-206 of human SOSTDC1 (NP_056279.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SOSTDC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 115-206 of human SOSTDC1 (NP_056279.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06694A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SOSTDC1 |
| Target Synonyms | DAND7; USAG1; CDA019; ECTODIN; SOSTDC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brian, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 115-206 of human SOSTDC1 (NP_056279.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGGYGTKYWSRRSSQEWRCVNDKTRTQRIQLQCQDGSTRTYKITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS | Uniprot ID | Q6X4U4 |
Uniprot Id
Q6X4U4
Target Species
Human
Target Name
SOSTDC1
Target Full Name
Sclerostin domain-containing protein 1
Target Function
May be involved in the onset of endometrial receptivity for implantation/sensitization for the decidual cell reaction Enhances Wnt signaling and inhibits TGF-beta signaling. Directly antagonizes activity of BMP2, BMP4, BMP6 and BMP7 in a dose-dependent manner.
Target Subcellular Location
Secreted.
Target Protein Families
Sclerostin family
Target Tissue Specificity
Highly expressed in kidney and weakly in lung.
Target Research Area
Signal Transduction
Target Synonyms
CDA019; DKFZp564D206; Ectodermal BMP inhibitor; Ectodin; sclerostin domain containing 1; Sclerostin domain containing protein 1; Sclerostin domain-containing protein 1; SOSD1_HUMAN; Sostdc1; USAG-1; USAG1; Uterine sensitization associated gene 1 protein; Uterine sensitization-associated gene 1 protein; Wise
Target Background
This gene is a member of the sclerostin family and encodes an N-glycosylated, secreted protein with a C-terminal cystine knot-like domain. This protein functions as a bone morphogenetic protein (BMP) antagonist. Specifically, it directly associates with BMPs, prohibiting them from binding their receptors, thereby regulating BMP signaling during cellular proliferation, differentiation, and programmed cell death.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
