Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SLC35A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC35A1 (NP_006407.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SLC35A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC35A1 (NP_006407.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06765A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SLC35A1 |
| Target Synonyms | CST; hCST; CDG2F; CMPST; SLC35A1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Jurkat, MCF7, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC35A1 (NP_006407.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAV | Uniprot ID | P78382 |
Uniprot Id
P78382
Target Species
Human
Target Name
SLC35A1
Target Full Name
CMP-sialic acid transporter
Target Function
Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function. Efficient CMP-sialic acid uptake depends on the presence of free CMP inside the vesicles, suggesting the proteins functions as an antiporter. Binds both CMP-sialic acid and free CMP, but has higher affinity for free CMP.
Target Involvement
Congenital disorder of glycosylation 2F (CDG2F)
Target Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.
Target Protein Families
Nucleotide-sugar transporter family, SLC35A subfamily
Target Synonyms
CMP-SA-Tr; CMP-Sia-Tr; CMP-sialic acid transporter; S35A1_HUMAN; Slc35a1; Solute carrier family 35 member A1
Target Background
The protein encoded by this gene is found in the membrane of the Golgi apparatus, where it transports nucleotide sugars into the Golgi. One such nucleotide sugar is CMP-sialic acid, which is imported into the Golgi by the encoded protein and subsequently glycosylated. Defects in this gene are a cause of congenital disorder of glycosylation type 2F (CDG2F). Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
