Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HABP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human HABP4 (NP_055097.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HABP4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human HABP4 (NP_055097.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06992A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HABP4 |
| Target Synonyms | IHABP4; IHABP-4; Ki-1/57; SERBP1L; HABP4 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse brain, Rat kidney | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HABP4 (NP_055097.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QQQLQRKRRDEAAAAAGAGPRGGRSPAGASGHRAGAGGRRESQKERKSLPAPVAQRPDSPGGGLQAPGQKRTPRRGEQQGWNDSRGPEGMLERAERRSYRE | Uniprot ID | Q5JVS0 |
Uniprot Id
Q5JVS0
Target Species
Human
Target Name
HABP4
Target Full Name
Intracellular hyaluronan-binding protein 4
Target Function
RNA-binding protein that plays a role in the regulation of transcription, pre-mRNA splicing and mRNA translation. Negatively regulates DNA-binding activity of the transcription factor MEF2C in myocardial cells in response to mechanical stress. Plays a role in pre-mRNA splicing regulation. Binds (via C-terminus) to poly(U) RNA. Involved in mRNA translation regulation, probably at the initiation step. Seems to play a role in PML-nuclear bodies formation.
Target Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, Stress granule. Cytoplasm, sarcoplasm. Nucleus, nuclear body. Nucleus, nucleolus. Nucleus speckle. Nucleus, Cajal body. Nucleus, gem.
Target Tissue Specificity
Highly expressed in brain, heart, and kidney, and moderately expressed in skeletal muscle. Also expressed in a variety of tumor cell lines and in activated but not resting leukocytes.
Target Synonyms
HABP4; Intracellular hyaluronan-binding protein 4; IHABP-4; IHABP4; Hyaluronan-binding protein 4; Ki-1/57 intracellular antigen
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
