Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ELL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-292 of human ELL2 (NP_036213.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ELL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-292 of human ELL2 (NP_036213.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06994A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ELL2 |
| Target Synonyms | MRCCAT1; ELL2 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-292 of human ELL2 (NP_036213.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TISQRPYRDRVIHLLALKAYKKPELLARLQKDGVNQKDKNSLGAILQQVANLNSKDLSYTLKDYVFKELQRDWPGYSEIDRRSLESVLSRKLN | Uniprot ID | O00472 |
Uniprot Id
O00472
Target Species
Human
Target Name
ELL2
Target Full Name
RNA polymerase II elongation factor ELL2
Target Function
Elongation factor component of the super elongation complex (SEC), a complex required to increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA. Component of the little elongation complex (LEC), a complex required to regulate small nuclear RNA (snRNA) gene transcription by RNA polymerase II and III. Plays a role in immunoglobulin secretion in plasma cells: directs efficient alternative mRNA processing, influencing both proximal poly(A) site choice and exon skipping, as well as immunoglobulin heavy chain (IgH) alternative processing. Probably acts by regulating histone modifications accompanying transition from membrane-specific to secretory IgH mRNA expression.
Target Subcellular Location
Nucleus.
Target Protein Families
ELL/occludin family
Target Synonyms
ELL related RNA polymerase II elongation factor; Ell2; ELL2_HUMAN; Elongation factor for RNA polymerase II 2; Elongation factor RNA for polymerase II 2; Elongation factor RNA polymerase II 2; RNA polymerase II elongation factor ELL2
Target Background
Involved in snRNA transcription by RNA polymerase II. Located in nucleoplasm. Part of transcription elongation factor complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
