-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Tubulin beta-1 chain was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 362-451 of human Tubulin beta-1 chain (NP_110400.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Tubulin beta-1 chain was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 362-451 of human Tubulin beta-1 chain (NP_110400.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07090A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Tubulin beta-1 chain |
| Target Synonyms | MACTHC1; Tubulin beta-1 chain | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 362-451 of human Tubulin beta-1 chain (NP_110400.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH | Uniprot ID | Q9H4B7 |
Uniprot Id
Q9H4B7
Target Species
Human
Target Name
TUBB1
Target Full Name
Tubulin beta-1 chain
Target Function
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
Target Involvement
Macrothrombocytopenia, autosomal dominant, TUBB1-related (MAD-TUBB1)
Target Subcellular Location
Cytoplasm, cytoskeleton.
Target Protein Families
Tubulin family
Target Tissue Specificity
Hematopoietic cell-specific. Major isotype in leukocytes, where it represents 50% of all beta-tubulins.
Target Synonyms
2810484G07Rik; beta 1 tubulin; Beta tubulin 1, class VI; Beta-tubulin; Class VI beta tubulin; dJ543J19.4; M(beta)1; TBB1_HUMAN; TUBB1; Tubulin beta 1 class VI; Tubulin beta-1 chain; Tubulin, beta 1; tubulin, beta1
Target Background
This gene encodes a member of the beta tubulin protein family. Beta tubulins are one of two core protein families (alpha and beta tubulins) that heterodimerize and assemble to form microtubules. This protein is specifically expressed in platelets and megakaryocytes and may be involved in proplatelet production and platelet release. A mutations in this gene is associated with autosomal dominant macrothrombocytopenia. Two pseudogenes of this gene are found on chromosome Y.
Notification