Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against DNAJC18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-350 of human DNAJC18 (NP_689899.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against DNAJC18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 260-350 of human DNAJC18 (NP_689899.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07136A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | DNAJC18 |
| Target Synonyms | DNAJC18 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BxPC-3, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 260-350 of human DNAJC18 (NP_689899.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSK | Uniprot ID | Q9H819 |
Uniprot Id
Q9H819
Target Species
Human
Target Name
DNAJC18
Target Full Name
DnaJ homolog subfamily C member 18
Target Subcellular Location
Membrane; Single-pass membrane protein.
Target Synonyms
DNAJC18; DnaJ homolog subfamily C member 18
Target Background
Predicted to enable Hsp70 protein binding activity. Predicted to be involved in cellular response to misfolded protein; chaperone cofactor-dependent protein refolding; and ubiquitin-dependent ERAD pathway. Predicted to be integral component of membrane. Predicted to be active in endoplasmic reticulum membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
