Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OSR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-115 of human OSR1 (NP_660303.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against OSR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 28-115 of human OSR1 (NP_660303.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07161A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OSR1 |
| Target Synonyms | ODD; OSR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, NCI-H460 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 28-115 of human OSR1 (NP_660303.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKPEITAGGSVPALKTKP | Uniprot ID | Q8TAX0 |
Uniprot Id
Q8TAX0
Target Species
Human
Target Name
OSR1
Target Full Name
Protein odd-skipped-related 1
Target Function
Transcription factor that plays a role in the regulation of embryonic heart and urogenital development.
Target Subcellular Location
Nucleus.
Target Protein Families
Odd C2H2-type zinc-finger protein family
Target Tissue Specificity
Expressed in adult colon, small intestine, prostate, testis, and fetal lung.
Target Synonyms
OSR1; ODD; Protein odd-skipped-related 1
Target Background
Enables sequence-specific double-stranded DNA binding activity. Involved in negative regulation of ion transmembrane transporter activity; positive regulation of gastrulation; and pronephros development. Located in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
