-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TLK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human TLK1 (NP_036422.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TLK1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human TLK1 (NP_036422.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07926A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TLK1 |
| Target Synonyms | PKU-beta; TLK1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human TLK1 (NP_036422.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FEYQGGNGSSPVRGIPPAIRSPQNSHSHSTPSSSVRPNSPSPTALAFGDHPIVQPKQLSFKIIQTDLTMLKLAALESNKIQDLEKKEGRIDDLLRANCDLR | Uniprot ID | Q9UKI8 |
Uniprot Id
Q9UKI8
Target Species
Human
Target Name
TLK1
Target Full Name
Serine/threonine-protein kinase tousled-like 1
Target Function
Rapidly and transiently inhibited by phosphorylation following the generation of DNA double-stranded breaks during S-phase. This is cell cycle checkpoint and ATM-pathway dependent and appears to regulate processes involved in chromatin assembly. Isoform 3 phosphorylates and enhances the stability of the t-SNARE SNAP23, augmenting its assembly with syntaxin. Isoform 3 protects the cells from the ionizing radiation by facilitating the repair of DSBs. In vitro, phosphorylates histone H3 at 'Ser-10'.
Target Subcellular Location
Nucleus.
Target Protein Families
Protein kinase superfamily, Ser/Thr protein kinase family
Target Tissue Specificity
Widely expressed. Present in fetal placenta, liver, kidney and pancreas but not heart or skeletal muscle. Also found in adult cell lines. Isoform 3 is ubiquitously expressed in all tissues examined.
Target Synonyms
PKU beta; PKU-beta; serine threonine protein kinase; Serine/threonine protein kinase tousled like 1; Serine/threonine-protein kinase tousled-like 1; SNARE protein kinase SNAK; Tlk1; TLK1_HUMAN; Tousled like kinase 1; Tousled-like kinase 1
Target Background
The protein encoded by this gene is a serine/threonine kinase that may be involved in the regulation of chromatin assembly. The encoded protein is only active when it is phosphorylated, and this phosphorylation is cell cycle-dependent, with the maximal activity of this protein coming during S phase. The catalytic activity of this protein is diminished by DNA damage and by blockage of DNA replication. Three transcript variants encoding different isoforms have been found for this gene.
Notification