-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PNRC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PNRC2 (NP_060231.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PNRC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PNRC2 (NP_060231.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08728A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PNRC2 |
| Target Synonyms | PNRC2 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PNRC2 (NP_060231.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGGGERYNIPAPQSRNVSKNQQQLNRQKTKEQNSQMKIVHKKKERGHGYNSSAAAWQAMQNGGKNKNFPNNQSWNSSLSGPRLLFKSQANQNYAGAKFSE | Uniprot ID | Q9NPJ4 |
Uniprot Id
Q9NPJ4
Target Species
Human
Target Name
PNRC2
Target Full Name
Proline-rich nuclear receptor coactivator 2
Target Function
Involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery. May act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. Required for UPF1/RENT1 localization to the P-body. Plays a role in glucocorticoid receptor-mediated mRNA degradation by interacting with the glucocorticoid receptor NR3C1 in a ligand-dependent manner when it is bound to the 5' UTR of target mRNAs and recruiting the RNA helicase UPF1 and the mRNA-decapping enzyme DCP1A, leading to RNA decay. Also acts as a nuclear receptor coactivator. May play a role in controlling the energy balance between energy storage and energy expenditure.
Target Subcellular Location
Nucleus. Cytoplasm, P-body.
Target Protein Families
PNRC family, PNRC2 subfamily
Target Tissue Specificity
Expressed in heart, lung, muscle and brain.
Target Synonyms
0610011E17Rik; D4Bwg0593e; FLJ20312; MGC11707; MGC93828; MGC99541; OTTMUSP00000010360; OTTMUSP00000010366; pnrc2; PNRC2_HUMAN; Proline rich nuclear receptor coactivator 2; Proline-rich nuclear receptor coactivator 2; RP11-4M23.5; RP23-161N17.3
Target Background
Involved in nuclear-transcribed mRNA catabolic process, nonsense-mediated decay. Located in Golgi apparatus; P-body; and nucleoplasm.
Notification